Description
Research Overview
LL-37 is a synthetic peptide corresponding to the only known human cathelicidin antimicrobial peptide. Composed of 37 amino acids, LL-37 is naturally produced by epithelial cells, neutrophils, and various immune cells as part of the innate immune system. It is widely studied in laboratory research for its interactions with innate immunity, antimicrobial activity, inflammatory signaling, wound biology, biofilm regulation, and host defense mechanisms.
LL-37 is an investigational research peptide and has not been approved for therapeutic use in humans. This material is supplied by Marsden Research Labs exclusively for qualified laboratory research applications and is not offered for human or veterinary use.
Chemical Information
| Compound Name | LL-37 |
| Common Name | Human Cathelicidin LL-37 |
| Compound Type | Synthetic antimicrobial peptide |
| Length | 37 amino acids |
| Molecular Weight | Approximately 4.5 kDa |
| Amino Acid Sequence | [LL-37, 37 aa] |
Physical Characteristics
| Appearance | White to off-white lyophilized powder. |
| Solubility | Water soluble under laboratory conditions. |
| Storage | Store frozen at -20°C or below for long-term stability. |
| Stability | Stability depends on laboratory storage conditions, handling, and repeated freeze-thaw exposure. |
Analytical Verification
Every batch offered by Marsden Research Labs is supported by batch-specific analytical verification whenever documentation is available. Analytical testing is performed to verify identity, assess purity, and provide supporting laboratory documentation for individual research batches.
| Identity Verification | Confirmed using Liquid Chromatography–Mass Spectrometry (LC-MS) when available. |
| Purity Analysis | Determined using High-Performance Liquid Chromatography (HPLC). |
| Batch Documentation | Each verified research batch is assigned a unique batch identifier for traceability. |
| Certificate of Analysis (COA) | Available for verified batches and includes analytical testing results when provided. |
| Laboratory Report | Additional laboratory documentation is provided for applicable batches when available. |
Batch-Specific Information
The batch number, purity value, testing date, Certificate of Analysis (COA), and laboratory report displayed near the top of this page correspond to the selected research sample and update automatically when a different batch or package size is selected.
Mechanism of Action
LL-37 is an amphipathic cationic peptide that interacts with microbial membranes and numerous host-cell receptors involved in innate immunity. Laboratory studies have investigated its role in membrane disruption of microorganisms, chemotactic signaling, cytokine modulation, biofilm regulation, epithelial barrier function, angiogenesis, and cellular migration. LL-37 also participates in immune cell recruitment and modulation of inflammatory signaling pathways, making it an important tool for studying host defense biology.
Because of its broad biological activity, LL-37 is frequently investigated in innate immunity, antimicrobial peptide biology, inflammatory signaling, wound biology, epithelial physiology, and immunomodulatory pathways.
Current Areas of Research
- Innate immune system signaling
- Antimicrobial peptide biology
- Inflammatory pathway regulation
- Biofilm formation and disruption
- Epithelial barrier function
- Cell migration and tissue remodeling
- Host defense mechanisms
Marsden Research Labs makes no representation regarding clinical outcomes or therapeutic applications.
Laboratory Handling
This material should be handled only by qualified laboratory personnel using appropriate research procedures.
Research samples should be stored according to accepted laboratory practices to preserve compound integrity. Stability may be affected by storage conditions, repeated freeze-thaw cycles, and handling methods.
Research Use Notice
This product is supplied exclusively for laboratory research purposes.
It is not intended for human or veterinary use, diagnosis, treatment, cure, prevention of disease, food use, cosmetic use, or consumption of any kind. Purchasers are responsible for ensuring compliance with all applicable laws and regulations governing the acquisition and use of research materials.
Reviews
There are no reviews yet.