LL-37

LL-37 research reference image

Research Member Access

Pricing, ordering, batch verification, certificates, and availability are available to registered research members.

Sign in or create account
Research use only. Not for human or veterinary use.

Select Amount to View Testing Data

Independent testing data by selected amount

Batch:

Select amount
Label Claim:

Select amount
Tested Content:

Select amount
Purity:

Select amount
Testing Date:

Select amount
Status:

Select amount

Fast U.S. Shipping. Ships Fast. Track Every Order.

This product is currently out of stock and unavailable.

✓ Added to cart · View cart →
SKU: LL-37

Research Overview

LL-37 is a synthetic 37-amino-acid peptide corresponding to the C-terminal antimicrobial peptide derived from the human cathelicidin precursor hCAP18. It is investigated in laboratory systems involving innate immune signaling, host-microbe interactions, microbial membrane biology, epithelial cell signaling, chemotactic pathways, and antimicrobial peptide structure-function relationships.

LL-37 is supplied by Marsden Research Labs exclusively for qualified laboratory research applications and is not offered for human or veterinary use.


Chemical Information

Compound Name LL-37
Common Name Human Cathelicidin LL-37
CAS Number 154947-66-7
Compound Type Synthetic cathelicidin-derived peptide
Length 37 amino acids
Chemical Formula C205H340N60O53
Molecular Weight Approximately 4493 g/mol
Amino Acid Sequence [LL-37, 37 aa]

Physical Characteristics

Appearance White to off-white lyophilized material.
Solubility Solubility characteristics depend on formulation and laboratory conditions.
Storage Store frozen at -20°C or below for long-term laboratory storage.
Stability Stability depends on the characteristics of the research material and may be affected by storage temperature, moisture, light exposure, solution conditions, repeated freeze-thaw cycles, and laboratory handling.

Analytical Verification

Every batch made available for purchase by Marsden Research Labs is supported by current, batch-specific third-party laboratory documentation. Products are not made available for purchase until applicable testing and Certificate of Analysis (COA) documentation are complete. Additional independent laboratory reports may be published for a batch when available.

Identity Verification May include Liquid Chromatography–Mass Spectrometry (LC-MS) or comparable analytical methods.
Purity Analysis May include High-Performance Liquid Chromatography (HPLC) or other methods appropriate to the individual sample.
Quantitative Analysis May include quantitative assessment appropriate to the individual batch and analytical method.
Batch Traceability Research batches are assigned unique batch identifiers corresponding to their applicable analytical results and documentation.
Certificate of Analysis (COA) Required for every batch made available for purchase and reflects the analytical results associated with that batch.
Laboratory Report Additional independent laboratory reports may be published for a batch when available.

Batch-Specific Information
The batch number, analytical results, testing date, Certificate of Analysis (COA), and any additional independent laboratory report displayed near the top of this page correspond to the selected research sample and update automatically when a different batch or package size is selected.


Investigated Molecular Mechanisms

LL-37 is an amphipathic cationic peptide investigated in experimental systems involving interactions with microbial membranes and host-cell signaling pathways. Its membrane-associated properties make it useful for studying peptide-membrane interactions, microbial susceptibility models, and antimicrobial peptide structure-function relationships.

LL-37 is also investigated in epithelial and immune-cell systems involving receptor-mediated signaling, cellular migration, chemotactic signaling, and intracellular pathways including MAPK/ERK-associated signaling. The specific signaling responses observed with LL-37 depend on cell type, experimental conditions, and biological model.


Current Areas of Research

  • Cathelicidin peptide biology
  • Innate immune signaling
  • Peptide-membrane interactions
  • Antimicrobial peptide structure-function relationships
  • Host-microbe interaction models
  • Epithelial cell signaling
  • Chemotactic and receptor-mediated signaling
  • Biofilm-associated microbial systems

Marsden Research Labs makes no representation regarding clinical outcomes or therapeutic applications.


Laboratory Handling

This material should be handled only by qualified laboratory personnel using appropriate research procedures.

Research samples should be stored and handled according to accepted laboratory practices appropriate to the research material. Material integrity may be affected by temperature, moisture, light exposure, solution conditions, repeated freeze-thaw cycles, and handling methods.


Research Use Notice

This product is supplied exclusively for laboratory research purposes.

It is not intended for human or veterinary use, diagnosis, treatment, cure, prevention of disease, food use, cosmetic use, or consumption of any kind. Purchasers are responsible for ensuring compliance with all applicable laws and regulations governing the acquisition and use of research materials.

Additional information

Amount

5mg

Reviews

There are no reviews yet.

Verified Purchasers Only
Reviews may be submitted only by verified purchasers. Sign in to your research account to continue.